LL-37 is a 37-amino acid peptide naturally produced by the human body as part of the innate immune system, and we offer a high-purity synthetic version for laboratory research.

• It belongs to the cathelicidin family and serves as one of the most important antimicrobial peptides in humans, helping defend against infections.
• Our LL-37 comes as a white lyophilized powder with ≥95% purity verified by HPLC for consistent and reliable research outcomes.
• Researchers value it for its broad biological activities beyond basic antimicrobial effects, including modulation of inflammation and tissue repair.
• The peptide consists of the specific sequence [LL-37, 37 aa], making it highly bioactive in controlled studies.
• We ensure every batch meets strict quality standards so scientists receive a stable, research-grade product suitable for advanced experiments

LL-37 works against microbes primarily by disrupting their cell membranes, leading to rapid destruction of bacteria, viruses, and fungi in research models.

• It inserts into lipid membranes of pathogens, creating pores that cause leakage and cell death without harming human cells in the same way.
• Our high-purity LL-37 shows strong effectiveness against both Gram-positive and Gram-negative bacteria in laboratory settings.
• It also inhibits biofilm formation, which helps researchers study solutions for chronic and resistant infections.
• The peptide interacts with microbial DNA and other internal structures, providing multiple attack mechanisms that reduce resistance potential.
• Studies using our LL-37 often explore its ability to neutralize viruses by damaging their envelopes and limiting replication.

Yes, LL-37 can support wound healing by promoting cell migration, new blood vessel formation, and tissue regeneration in research applications.

• It stimulates keratinocyte movement to close wounds faster while reducing excessive inflammation at injury sites.
• Researchers use our LL-37 to study its role in enhancing collagen production and skin barrier repair.
• The peptide attracts immune cells to the wound area, helping clear debris and accelerate the natural healing process.
• Laboratory data shows LL-37 improves re-epithelialization, making it valuable for chronic wound and burn research.
• We provide stable, high-quality LL-37 that maintains its bioactive properties for accurate wound healing experiments.

Yes, LL-37 is highly suitable for immune system research because it modulates both pro-inflammatory and anti-inflammatory responses in laboratory studies.

• It helps balance immune activity by recruiting immune cells while preventing damaging over-inflammation.
• Scientists explore our LL-37 for its effects on Toll-like receptors and other key immune signaling pathways.
• The peptide influences cytokine production, offering insights into infection control and autoimmune conditions.
• Research with LL-37 contributes to understanding host defense mechanisms and potential therapeutic applications.
• We deliver pure, consistent LL-37 that supports reproducible results in immunology and inflammation studies.

LL-37 differs from traditional antibiotics by attacking microbes through multiple physical and biological pathways rather than targeting single metabolic processes.

• It disrupts membranes directly, making it effective against resistant strains where many antibiotics fail.
• Our research-grade LL-37 shows lower likelihood of inducing resistance because it uses several simultaneous mechanisms.
• Unlike many antibiotics, it also regulates immune responses and promotes healing alongside its antimicrobial action.
• LL-37 works against a broader spectrum including viruses and fungi, expanding research possibilities.
• Researchers choose our LL-37 for studies on alternative approaches to combat superbugs and chronic infections.

LL-37 should be stored in a cool, dry place at -20°C to maintain maximum stability and potency for research use.

• Keep the lyophilized powder in its original airtight vial to protect it from moisture and light exposure.
• We recommend using a dedicated laboratory freezer for long-term storage of our LL-37 to ensure consistent quality over months.
• Avoid repeated freeze-thaw cycles by aliquoting the powder into smaller sterile containers before storage.
• Once reconstituted in sterile water or buffer, store the solution at 4°C and use within a few days for best results.
• Proper storage preserves the peptide’s antimicrobial and biological activity, giving researchers reliable performance in experiments.
• Our packaging includes clear storage guidelines so you can maintain the integrity of LL-37 from delivery to final use.

Our LL-37 is synthetic, produced through advanced laboratory methods to ensure high purity and batch-to-batch consistency for research.

• Synthetic production allows us to deliver ≥95% pure LL-37 that matches the exact human sequence without biological contaminants.
• This form provides researchers with a stable, reliable product identical in structure to the natural human cathelicidin peptide.
• We use solid-phase peptide synthesis techniques to create LL-37 with precise amino acid ordering and minimal impurities.
• Synthetic LL-37 eliminates variability found in natural extracts, making it ideal for reproducible scientific studies.
• Customers benefit from our controlled manufacturing process that guarantees safety and quality for laboratory applications.

LL-37 is widely used in research areas including antimicrobial studies, wound healing, immunology, and inflammation modulation.

• Scientists explore its broad-spectrum activity against resistant bacteria, viruses, and fungi in infection control research.
• Our LL-37 supports studies on tissue repair, skin regeneration, and chronic wound treatment models.
• It plays a key role in immunology research focused on innate immune responses and cytokine regulation.
• Researchers investigate LL-37 for potential applications in inflammatory diseases, autoimmune conditions, and cancer biology.
• Biofilm disruption and host defense mechanism studies frequently utilize high-purity LL-37 from our supply.
• The peptide’s versatility makes it valuable for dermatology, respiratory, and gastrointestinal research projects.

Yes, LL-37 has strong anti-biofilm properties that help prevent and disrupt protective microbial communities in laboratory research.

• It penetrates biofilms and kills embedded bacteria that are often resistant to conventional treatments.
• Our high-purity LL-37 inhibits initial biofilm formation while breaking down existing structures in test models.
• This capability makes it a valuable tool for studying chronic infections where biofilms cause persistent problems.
• LL-37 works synergistically with other agents to enhance biofilm eradication in controlled experiments.
• Researchers use our LL-37 to explore new strategies against antibiotic-resistant infections linked to biofilms.

Yes, LL-37 can be used with other compounds in research to explore synergistic effects and enhanced therapeutic potential.

• Scientists often combine it with traditional antibiotics to overcome resistance and improve treatment outcomes in lab studies.
• Our LL-37 pairs well with other peptides or growth factors for advanced wound healing and tissue repair research.
• Combination studies with anti-inflammatory agents help examine balanced immune modulation effects.
• Researchers test LL-37 alongside antiviral or antifungal compounds to broaden antimicrobial activity.
• Proper laboratory protocols ensure safe and effective co-administration during experiments.
• We provide consistent, pure LL-37 that supports reliable results when used in multi-compound research designs.

LL-37 typically comes as a white lyophilized powder that is easy to reconstitute for laboratory research applications.

• This dry powder form ensures maximum stability during shipping and long-term storage.
• Our LL-37 arrives in sealed, sterile vials that protect the peptide from contamination and degradation.
• The powder dissolves quickly in sterile water, saline, or research buffers to create clear, ready-to-use solutions.
• Lyophilized format allows precise dosing and reduces the risk of breakdown compared to pre-mixed liquids.
• We package it in convenient vial sizes suitable for various research protocols and experiment scales.

LL-37 in solution remains stable for short-term use when handled according to standard laboratory protocols.

• Freshly reconstituted solutions maintain full activity when kept at 4°C and used within 24–48 hours.
• For longer storage of solutions, we recommend freezing aliquots at -20°C or lower to preserve potency.
• Avoid repeated freeze-thaw cycles, as they can reduce the peptide’s effectiveness over time.
• Our high-purity LL-37 shows excellent stability in common research buffers with proper pH control.
• Always prepare fresh working solutions for critical experiments to ensure optimal biological activity.

Yes, LL-37 shows antiviral potential by disrupting viral envelopes and inhibiting replication in laboratory studies.

• It targets enveloped viruses through direct membrane disruption, limiting their ability to infect cells.
• Research indicates LL-37 can interfere with viral attachment and entry processes in cell culture models.
• Our product supports studies on its activity against various viral families in controlled settings.
• The peptide’s positive charge helps it interact with negatively charged viral components effectively.
• Scientists continue exploring LL-37 for broader antiviral applications and combination therapies.

Laboratories, research institutions, universities, and independent scientists typically order LL-37 for advanced studies.

• Academic researchers use it to investigate innate immunity, infection control, and tissue regeneration.
• Pharmaceutical and biotechnology labs explore its potential in drug development and peptide therapeutics.
• Dermatology and wound care research groups study its role in skin healing and barrier function.
• Immunology departments value LL-37 for experiments on inflammation modulation and host defense.
• We serve professionals who require consistent, high-purity peptides for reproducible scientific results.

We guarantee ≥95% purity for LL-37, verified by High-Performance Liquid Chromatography (HPLC) testing.

• This high purity level ensures minimal impurities and reliable performance in sensitive experiments.
• Every batch undergoes rigorous quality control to maintain consistency across orders.
• Our advanced synthesis and purification processes deliver research-grade LL-37 you can trust.
• Certificates of analysis are available to confirm purity and support laboratory documentation needs.
• High purity reduces variables in your research, allowing clearer interpretation of results.